December 1, 2023

Human Monoclonal Ig4 Antibody For Asthma

cDNA - Asthma: Lung

C1236152Ld-1 40 reactions
EUR 899

Human Antibody Laboratories manufactures the human monoclonal ig4 antibody for asthma reagents distributed by Genprice. The Human Monoclonal Ig4 Antibody For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Ig4 Antibody

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 471.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 477.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 564
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 474
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 495.6
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 482.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405.

Monoclonal antibody for SUR1 and SUR2B

0.1mg
EUR 470.4
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488.

Ig4 Antibody information

Monoclonal antibody for Tau

SMC-607D-DY488 0.1mg
EUR 536.4
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 488.

Monoclonal antibody for Tau

SMC-607D-DY594 0.1mg
EUR 538.8
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 594.

Monoclonal antibody for Tau

SMC-607D-DY633 0.1mg
EUR 532.8
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 633.

Monoclonal antibody for Tau

SMC-607D-FITC 0.1mg
EUR 535.2
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with FITC.

Monoclonal antibody for Tau

SMC-607D-HRP 0.1mg
EUR 530.4
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with HRP.

Monoclonal antibody for Tau

SMC-607D-P594 0.1mg
EUR 552
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with PE/ATTO 594.

Monoclonal antibody for Tau

SMC-607D-PCP 0.1mg
EUR 543.6
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with PerCP.

Monoclonal antibody for Tau

SMC-607D-RPE 0.1mg
EUR 541.2
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with RPE.

Monoclonal antibody for Tau

SMC-607D-STR 0.1mg
EUR 542.4
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Streptavidin.

Monoclonal antibody for Tau

SMC-607S 0.012mg
EUR 78
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated.

Monoclonal antibody for Tau

SMC-608D 0.1mg
EUR 489.6
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated.

Monoclonal antibody for Tau

SMC-608D-A390 0.1mg
EUR 546
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 390.

Monoclonal antibody for Tau

SMC-608D-A488 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 488.

Monoclonal antibody for Tau

SMC-608D-A565 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 565.

Monoclonal antibody for Tau

SMC-608D-A594 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 594.

Monoclonal antibody for Tau

SMC-608D-A633 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 633.

Monoclonal antibody for Tau

SMC-608D-A655 0.1mg
EUR 544.8
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 655.