DHBE-Asthma, guaranteed for B-ALI |
|
LO00194911S |
Westburg |
each |
EUR 2452.27 |
Human Antibody Laboratories manufactures the human monoclonal ig4 antibody for asthma reagents distributed by Genprice. The Human Monoclonal Ig4 Antibody For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Ig4 Antibody
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 471.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 477.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 564 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 474 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 495.6 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 482.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
|
Stressmarq |
0.1mg |
EUR 470.4 |
|
|
|
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Ig4 Antibody information
Asthma relating compound 1 |
|
T10508-10mg |
TargetMol Chemicals |
10mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-1g |
TargetMol Chemicals |
1g |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-1mg |
TargetMol Chemicals |
1mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-50mg |
TargetMol Chemicals |
50mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
T10508-5mg |
TargetMol Chemicals |
5mg |
Ask for price |
|
|
|
Description: Asthma relating compound 1 |
Asthma relating compound 1 |
|
MBS5766156-5mg |
MyBiosource |
5mg |
EUR 915 |
Asthma relating compound 1 |
|
MBS5766156-5x5mg |
MyBiosource |
5x5mg |
EUR 3970 |
Monoclonal antibody for Kv3.2 |
|
SMC-492D |
Stressmarq |
0.1mg |
EUR 423.6 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is not conjugated. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A390 |
Stressmarq |
0.1mg |
EUR 480 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 390. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A488 |
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 488. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A565 |
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 565. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A594 |
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 594. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A633 |
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 633. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A655 |
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 655. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A680 |
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 680. |
Monoclonal antibody for Kv3.2 |
|
SMC-492D-A700 |
Stressmarq |
0.1mg |
EUR 478.8 |
|
|
|
Description: A monoclonal antibody from clone S410-17 against Human Kv3.2. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 474-613 (Cytoplasmic C-terminus) of rat Kv3.2a. The antibody is tested and validated for WB, IHC, ICC/IF assays with the following recommended dilutions: WB (1:1000). This MAb for Kv3.2 is conjugated with ATTO 700. |
