cDNA - Asthma: Lung |
|||
C1236152Ld-1 | Biochain | 40 reactions | EUR 899 |
Human Antibody Laboratories manufactures the human monoclonal ig4 antibody for asthma reagents distributed by Genprice. The Human Monoclonal Ig4 Antibody For Asthma reagent is RUO (Research Use Only) to test human serum or cell culture lab samples. To purchase these products, for the MSDS, Data Sheet, protocol, storage conditions/temperature or for the concentration, please contact human Antibody. Other Human products are available in stock. Specificity: Human Category: Monoclonal Group: Ig4 Antibody
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 471.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Alkaline Phosphatase. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 477.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 564 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with APC/Cy7. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 474 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Biotin. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 495.6 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 350. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 482.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 405. |
Monoclonal antibody for SUR1 and SUR2B |
||
Stressmarq | 0.1mg | EUR 470.4 |
Description: A monoclonal antibody from clone S323A-31 against Rat SUR1 and SUR2B. The host species for the production of this antibody is Mouse. The antigen used for immunization is Rat Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B. The antibody is tested and validated for WB, ICC/IF assays with the following recommended dilutions: WB (1:1000), IHC (1:1000), ICC/IF (1:100). This MAb for SUR1 and SUR2B is conjugated with Dylight 488. |
Monoclonal antibody for Tau |
|||
SMC-607D-DY488 | Stressmarq | 0.1mg | EUR 536.4 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 488. |
Monoclonal antibody for Tau |
|||
SMC-607D-DY594 | Stressmarq | 0.1mg | EUR 538.8 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 594. |
Monoclonal antibody for Tau |
|||
SMC-607D-DY633 | Stressmarq | 0.1mg | EUR 532.8 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Dylight 633. |
Monoclonal antibody for Tau |
|||
SMC-607D-FITC | Stressmarq | 0.1mg | EUR 535.2 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with FITC. |
Monoclonal antibody for Tau |
|||
SMC-607D-HRP | Stressmarq | 0.1mg | EUR 530.4 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with HRP. |
Monoclonal antibody for Tau |
|||
SMC-607D-P594 | Stressmarq | 0.1mg | EUR 552 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with PE/ATTO 594. |
Monoclonal antibody for Tau |
|||
SMC-607D-PCP | Stressmarq | 0.1mg | EUR 543.6 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with PerCP. |
Monoclonal antibody for Tau |
|||
SMC-607D-RPE | Stressmarq | 0.1mg | EUR 541.2 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with RPE. |
Monoclonal antibody for Tau |
|||
SMC-607D-STR | Stressmarq | 0.1mg | EUR 542.4 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with Streptavidin. |
Monoclonal antibody for Tau |
|||
SMC-607S | Stressmarq | 0.012mg | EUR 78 |
Description: A monoclonal antibody from clone 1D5 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated. |
Monoclonal antibody for Tau |
|||
SMC-608D | Stressmarq | 0.1mg | EUR 489.6 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is not conjugated. |
Monoclonal antibody for Tau |
|||
SMC-608D-A390 | Stressmarq | 0.1mg | EUR 546 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 390. |
Monoclonal antibody for Tau |
|||
SMC-608D-A488 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 488. |
Monoclonal antibody for Tau |
|||
SMC-608D-A565 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 565. |
Monoclonal antibody for Tau |
|||
SMC-608D-A594 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 594. |
Monoclonal antibody for Tau |
|||
SMC-608D-A633 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 633. |
Monoclonal antibody for Tau |
|||
SMC-608D-A655 | Stressmarq | 0.1mg | EUR 544.8 |
Description: A monoclonal antibody from clone 3D4 against Human Tau. The host species for the production of this antibody is Mouse. The antigen used for immunization is Human Recombinant Tau441 (2N4R), P301S mutant Protein Pre-formed Fibrils. The antibody is tested and validated for WB, DB, ICC/IF, ELISA assays with the following recommended dilutions: WB (1:1000). This MAb for Tau is conjugated with ATTO 655. |